3n3f/2/4:B/5:B

Sequences
>3n3f-a2-m4-cB (length=53) [Search sequence]
LVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPA
>3n3f-a2-m5-cB (length=53) [Search sequence]
LVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPA
Structure information
PDB ID 3n3f (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Human Collagen XV Trimerization Domain: A Potent Trimerizing Unit Common to Multiplexin Collagens
Assembly ID 2
Resolution 2.005Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID B B
UniProt accession P39059 P39059
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3n3f-a2-m4-cB_3n3f-a2-m5-cB.pdb.gz
Full biological assembly
Download: 3n3f-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3n3f/1/1:A/2:A 3n3f/1/1:A/3:A 3n3f/1/2:A/3:A 3n3f/2/1:B/4:B 3n3f/2/1:B/5:B

[Back to Home]