3n5b/1/2:B/3:B

Sequences
>3n5b-a1-m2-cB (length=86) [Search sequence]
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLE
NRLRNLRRNGQSQEYDQLQSVFQRTF
>3n5b-a1-m3-cB (length=86) [Search sequence]
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLE
NRLRNLRRNGQSQEYDQLQSVFQRTF
Structure information
PDB ID 3n5b (database links: RCSB PDB PDBe PDBj PDBsum)
Title The complex of PII and PipX from Anabaena
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession Q8YZH5 Q8YZH5
Species 103690 (Nostoc sp. PCC 7120 = FACHB-418) 103690 (Nostoc sp. PCC 7120 = FACHB-418)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3n5b-a1-m2-cB_3n5b-a1-m3-cB.pdb.gz
Full biological assembly
Download: 3n5b-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3n5b/1/1:B/2:B 3n5b/1/1:B/3:B

[Back to Home]