3n5b/1/2:B/3:B

Sequences

>3n5b-a1-m2-cB (length=86) [Search sequence]

SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLE NRLRNLRRNGQSQEYDQLQSVFQRTF

>3n5b-a1-m3-cB (length=86) [Search sequence]

SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLE NRLRNLRRNGQSQEYDQLQSVFQRTF

Structure information

PDB ID	3n5b (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The complex of PII and PipX from Anabaena
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	Q8YZH5	Q8YZH5
Species	103690 (Nostoc sp. PCC 7120 = FACHB-418)	103690 (Nostoc sp. PCC 7120 = FACHB-418)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3n5b-a1-m2-cB_3n5b-a1-m3-cB.pdb.gz

Full biological assembly Download: 3n5b-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3n5b/1/1:B/2:B 3n5b/1/1:B/3:B