3n7d/1/1:B/1:A

Sequences
>3n7d-a1-m1-cB (length=55) [Search sequence]
VVKTYDLQDGSKVHVFKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
>3n7d-a1-m1-cA (length=59) [Search sequence]
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
Structure information
PDB ID 3n7d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of CopK bound to Cu(I) and Cu(II)
Assembly ID 1
Resolution 2.149Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q58AD3 Q58AD3
Species 266264 (Cupriavidus metallidurans CH34) 266264 (Cupriavidus metallidurans CH34)
Function annotation BioLiP:3n7dB BioLiP:3n7dA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3n7d-a1-m1-cB_3n7d-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3n7d-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3dso/2/1:A/2:A 3dsp/1/1:A/2:A 3n7e/1/1:A/1:B

[Back to Home]