3n7d/1/1:B/1:A

Sequences

>3n7d-a1-m1-cB (length=55) [Search sequence]

VVKTYDLQDGSKVHVFKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD

>3n7d-a1-m1-cA (length=59) [Search sequence]

NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD

Structure information

PDB ID	3n7d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CopK bound to Cu(I) and Cu(II)
Assembly ID	1
Resolution	2.149Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q58AD3	Q58AD3
Species	266264 (Cupriavidus metallidurans CH34)	266264 (Cupriavidus metallidurans CH34)
Function annotation	BioLiP:3n7dB	BioLiP:3n7dA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3n7d-a1-m1-cB_3n7d-a1-m1-cA.pdb.gz

Full biological assembly Download: 3n7d-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3dso/2/1:A/2:A 3dsp/1/1:A/2:A 3n7e/1/1:A/1:B