3n7n/1/1:F/1:E

Sequences
>3n7n-a1-m1-cF (length=30) [Search sequence]
TLLQLLSNYYKAKLDSERIYNEYVQSQYEF
>3n7n-a1-m1-cE (length=31) [Search sequence]
TLLQLLSNYYKAKLDSERIYNEYVQSQYEFA
Structure information
PDB ID 3n7n (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Csm1/Lrs4 complex
Assembly ID 1
Resolution 3.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession Q04087 Q04087
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3n7n-a1-m1-cF_3n7n-a1-m1-cE.pdb.gz
Full biological assembly
Download: 3n7n-assembly1.cif.gz

[Back to Home]