3nb3/1/23:C/9:C

Sequences
>3nb3-a1-m23-cC (length=137) [Search sequence]
APKDNTWYTGAKLGWSQHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYAYKAQGVQLT
AKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLE
YQWTNGMLSLGVSYRFG
>3nb3-a1-m9-cC (length=137) [Search sequence]
APKDNTWYTGAKLGWSQHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYAYKAQGVQLT
AKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLE
YQWTNGMLSLGVSYRFG
Structure information
PDB ID 3nb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The host outer membrane proteins OmpA and OmpC are packed at specific sites in the Shigella phage Sf6 virion as structural components
Assembly ID 1
Resolution 19.0Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 1055
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 23 9
Chain ID C C
UniProt accession P0A910 P0A910
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nb3-a1-m23-cC_3nb3-a1-m9-cC.pdb.gz
Full biological assembly
Download: 3nb3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nb3/1/10:C/5:C 3nb3/1/11:C/37:C 3nb3/1/12:C/46:C 3nb3/1/13:C/44:C 3nb3/1/14:C/28:C 3nb3/1/15:C/20:C 3nb3/1/16:C/27:C 3nb3/1/17:C/51:C 3nb3/1/18:C/59:C 3nb3/1/19:C/38:C 3nb3/1/1:C/22:C 3nb3/1/21:C/42:C 3nb3/1/24:C/53:C 3nb3/1/25:C/30:C 3nb3/1/26:C/52:C 3nb3/1/29:C/43:C 3nb3/1/2:C/41:C 3nb3/1/31:C/57:C 3nb3/1/32:C/6:C 3nb3/1/33:C/4:C 3nb3/1/34:C/48:C 3nb3/1/35:C/40:C 3nb3/1/36:C/47:C 3nb3/1/39:C/58:C 3nb3/1/3:C/49:C 3nb3/1/45:C/50:C 3nb3/1/54:C/8:C 3nb3/1/55:C/60:C 3nb3/1/56:C/7:C

[Back to Home]