3ncp/6/4:D/5:D

Sequences

>3ncp-a6-m4-cD (length=99) [Search sequence]

MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQEVTLLPKVKLEIVVKDDAVEEV IGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDSL

>3ncp-a6-m5-cD (length=99) [Search sequence]

MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQEVTLLPKVKLEIVVKDDAVEEV IGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDSL

Structure information

PDB ID	3ncp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	GlnK2 from Archaeoglobus fulgidus
Assembly ID	6
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	70
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	5
Chain ID	D	D
UniProt accession	O28527	O28527
Species	2234 (Archaeoglobus fulgidus)	2234 (Archaeoglobus fulgidus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3ncp-a6-m4-cD_3ncp-a6-m5-cD.pdb.gz

Full biological assembly Download: 3ncp-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ncp/1/1:A/2:A 3ncp/1/1:A/3:A 3ncp/1/2:A/3:A 3ncp/2/1:B/2:B 3ncp/2/1:B/3:B 3ncp/2/2:B/3:B 3ncp/3/1:C/4:C 3ncp/3/1:C/5:C 3ncp/3/4:C/5:C 3ncp/4/1:D/4:D 3ncp/4/1:D/5:D 3ncp/4/4:D/5:D 3ncp/5/1:A/2:A 3ncp/5/1:A/3:A 3ncp/5/1:B/2:B 3ncp/5/1:B/3:B 3ncp/5/2:A/3:A 3ncp/5/2:B/3:B 3ncp/6/1:C/4:C 3ncp/6/1:C/5:C 3ncp/6/1:D/4:D 3ncp/6/1:D/5:D 3ncp/6/4:C/5:C 3ncq/1/1:A/1:B 3ncq/1/1:A/1:C 3ncq/1/1:B/1:C 3ncq/2/1:A/1:B 3ncq/2/1:A/1:C 3ncq/2/1:B/1:C 3ncq/2/2:A/2:B 3ncq/2/2:A/2:C 3ncq/2/2:B/2:C 3ncr/1/1:A/1:C 3ncr/1/1:B/1:A 3ncr/1/1:B/1:C 3ncr/2/1:A/1:C 3ncr/2/1:B/1:A 3ncr/2/1:B/1:C 3ncr/2/2:A/2:C 3ncr/2/2:B/2:A 3ncr/2/2:B/2:C

Other dimers with similar sequences but different poses

3ncp/6/5:D/4:C 3ncp/5/1:B/2:A 3ncp/5/2:B/3:A 3ncp/5/3:B/1:A 3ncp/6/1:D/5:C 3ncp/6/4:D/1:C 3ncq/2/1:A/2:C 3ncq/2/1:B/2:B 3ncq/2/2:A/1:C 3ncr/2/1:A/2:C 3ncr/2/1:B/2:B 3ncr/2/2:A/1:C