3nd5/1/1:C/1:D

Sequences

>3nd5-a1-m1-cC (length=152) [Search sequence]

MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVR VIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYA HVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK

>3nd5-a1-m1-cD (length=152) [Search sequence]

MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVR VIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYA HVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK

Structure information

PDB ID	3nd5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of phosphopantetheine adenylyltransferase (PPAT) from Enterococcus faecalis
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q831P9	Q831P9
Species	1351 (Enterococcus faecalis)	1351 (Enterococcus faecalis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3nd5-a1-m1-cC_3nd5-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3nd5-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3nd5/1/1:A/1:B 3nd5/1/1:E/1:F 3nd6/1/1:A/1:B 3nd6/1/1:C/1:D 3nd6/1/1:E/1:F 3nd7/1/1:A/1:B 3nd7/1/1:C/1:D 3nd7/1/1:E/1:F
Other dimers with similar sequences but different poses	3nd5/1/1:C/1:E 3nd5/1/1:A/1:C 3nd5/1/1:A/1:E 3nd5/1/1:B/1:D 3nd5/1/1:B/1:F 3nd5/1/1:D/1:F 3nd6/1/1:A/1:C 3nd6/1/1:A/1:E 3nd6/1/1:B/1:D 3nd6/1/1:B/1:F 3nd6/1/1:C/1:E 3nd6/1/1:D/1:F 3nd7/1/1:A/1:C 3nd7/1/1:A/1:E 3nd7/1/1:B/1:D 3nd7/1/1:B/1:F 3nd7/1/1:C/1:E 3nd7/1/1:D/1:F