3nd5/1/1:C/1:D

Sequences
>3nd5-a1-m1-cC (length=152) [Search sequence]
MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVR
VIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYA
HVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK
>3nd5-a1-m1-cD (length=152) [Search sequence]
MRKIALFPGSFDPMTNGHLNLIERSAKLFDEVIIGVFILFTPEEKKYLIEEATKEMPNVR
VIMQETQLTVESAKSLGANFLIRGIRNVKDYEYEKDIAKMNQHLAPEIETVFLLAEEPYA
HVSSSLLKEVLRFGGDVSDYLPPNIYHALKQK
Structure information
PDB ID 3nd5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of phosphopantetheine adenylyltransferase (PPAT) from Enterococcus faecalis
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q831P9 Q831P9
Species 1351 (Enterococcus faecalis) 1351 (Enterococcus faecalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nd5-a1-m1-cC_3nd5-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3nd5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nd5/1/1:A/1:B 3nd5/1/1:E/1:F 3nd6/1/1:A/1:B 3nd6/1/1:C/1:D 3nd6/1/1:E/1:F 3nd7/1/1:A/1:B 3nd7/1/1:C/1:D 3nd7/1/1:E/1:F
Other dimers with similar sequences but different poses
  • 3nd5/1/1:C/1:E 3nd5/1/1:A/1:C 3nd5/1/1:A/1:E 3nd5/1/1:B/1:D 3nd5/1/1:B/1:F 3nd5/1/1:D/1:F 3nd6/1/1:A/1:C 3nd6/1/1:A/1:E 3nd6/1/1:B/1:D 3nd6/1/1:B/1:F 3nd6/1/1:C/1:E 3nd6/1/1:D/1:F 3nd7/1/1:A/1:C 3nd7/1/1:A/1:E 3nd7/1/1:B/1:D 3nd7/1/1:B/1:F 3nd7/1/1:C/1:E 3nd7/1/1:D/1:F
  • [Back to Home]