3ndz/1/1:B/1:D

Sequences

>3ndz-a1-m1-cB (length=345) [Search sequence]

STAFTGVRDVPAQQIVNEMKVGWNLGNTMDAIGGETNWGNPMTTHAMINKIKEAGFNTLR
LPVTWDGHMGAAPEYTIDQTWMKRVEEIANYAFDNDMYVIINLHHENEWLKPFYANEAQV
KAQLTKVWTQIANNFKKYGDHLIFETMNEPRPVGASLQWTGGSYENREVVNRYNLTAVNA
IRATGGNNATRYIMVPTLAASAMSTTINDLVIPNNDSKVIVSLHMYSPYFFAMDINGTSS
WGSDYDKSSLDSEFDAVYNKFVKNGRAVVIGEMGSINKNNTAARVTHAEYYAKSAKARGL
TPIWWDNGYSVAGKAETFGIFNRSNLTWDAPEVMKAFIKGIGGSS

>3ndz-a1-m1-cD (length=345) [Search sequence]

Structure information

PDB ID	3ndz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose
Assembly ID	1
Resolution	2.08Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	P28623	P28623
Species	1493 (Clostridium cellulovorans)	1493 (Clostridium cellulovorans)
Function annotation	BioLiP:3ndzB	BioLiP:3ndzD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3ndz-a1-m1-cB_3ndz-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3ndz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3ndy/1/1:B/1:D 3ndy/1/1:C/1:A 3ndz/1/1:A/1:C
Other dimers with similar sequences but different poses	3ndz/1/1:A/1:D 3ndy/1/1:A/1:D 3ndy/1/1:C/1:B 3ndz/1/1:B/1:C