3nfk/3/1:B/1:A

Sequences
>3nfk-a3-m1-cB (length=91) [Search sequence]
HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLING
RDIAEHTHDQVVLFIKASCESGELMLLVRPN
>3nfk-a3-m1-cA (length=92) [Search sequence]
DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGR
DIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Structure information
PDB ID 3nfk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies virus G protein
Assembly ID 3
Resolution 1.43Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 0.989
PubMed citation 22000519
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P29074 P29074
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3nfkB BioLiP:3nfkA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nfk-a3-m1-cB_3nfk-a3-m1-cA.pdb.gz
Full biological assembly
Download: 3nfk-assembly3.cif.gz

[Back to Home]