3nfl/5/2:D/1:A

Sequences
>3nfl-a5-m2-cD (length=89) [Search sequence]
DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGR
DIAEHTHDQVVLFIKASCEGELMLLVRPN
>3nfl-a5-m1-cA (length=92) [Search sequence]
HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLING
RDIAEHTHDQVVLFIKASCERHSGELMLLVRP
Structure information
PDB ID 3nfl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A NMDA receptor subunit
Assembly ID 5
Resolution 1.91Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 0.989
PubMed citation 22000519
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID D A
UniProt accession P29074 P29074
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3nflD BioLiP:3nflA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nfl-a5-m2-cD_3nfl-a5-m1-cA.pdb.gz
Full biological assembly
Download: 3nfl-assembly5.cif.gz

[Back to Home]