3nfl/5/2:D/1:A

Sequences

>3nfl-a5-m2-cD (length=89) [Search sequence]

DNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGR DIAEHTHDQVVLFIKASCEGELMLLVRPN

>3nfl-a5-m1-cA (length=92) [Search sequence]

HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLING RDIAEHTHDQVVLFIKASCERHSGELMLLVRP

Structure information

PDB ID	3nfl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A NMDA receptor subunit
Assembly ID	5
Resolution	1.91Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	0.989
PubMed citation	22000519

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	D	A
UniProt accession	P29074	P29074
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3nflD	BioLiP:3nflA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3nfl-a5-m2-cD_3nfl-a5-m1-cA.pdb.gz

Full biological assembly Download: 3nfl-assembly5.cif.gz