3ngt/5/1:D/1:E

Sequences
>3ngt-a5-m1-cD (length=150) [Search sequence]
SSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFP
ALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDS
VESAEREIAFWFKADEIASWTSHSVSQIYE
>3ngt-a5-m1-cE (length=150) [Search sequence]
SSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFFP
ALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSDS
VESAEREIAFWFKADEIASWTSHSVSQIYE
Structure information
PDB ID 3ngt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Leishmania NDKb complexed with AMP.
Assembly ID 5
Resolution 2.57Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
PubMed citation 21528129
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q9U1E1 Q9U1E1
Species 5664 (Leishmania major) 5664 (Leishmania major)
Function annotation BioLiP:3ngtD BioLiP:3ngtE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ngt-a5-m1-cD_3ngt-a5-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ngt-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ngs/1/1:B/1:A 3ngs/1/1:C/2:C 3ngs/1/2:B/2:A 3ngt/1/1:C/1:F 3ngt/1/1:D/1:E 3ngt/2/1:H/1:G 3ngt/2/1:J/1:K 3ngt/2/1:L/1:I 3ngt/3/1:B/1:A 3ngt/4/1:C/1:F 3ngt/6/1:H/1:G 3ngt/7/1:L/1:I 3ngt/8/1:M/1:N 3ngu/1/1:A/1:B 3ngu/1/2:A/2:B 3ngu/1/3:A/3:B 4kpc/1/1:B/1:A 4kpc/1/2:B/2:A 4kpc/1/3:B/3:A 4kpc/2/1:B/1:A 5c7p/1/1:A/1:B 5c7p/1/1:C/2:C 5c7p/1/2:A/2:B 5caa/1/1:A/1:B 5cab/1/1:B/1:A 5cab/1/2:B/2:A 5cab/1/3:B/3:A
Other dimers with similar sequences but different poses
  • 3ngu/1/2:B/3:B 3ngs/1/1:A/2:C 3ngs/1/1:B/1:C 3ngs/1/1:B/2:A 3ngs/1/1:C/2:A 3ngs/1/2:B/1:A 3ngs/1/2:B/2:C 3ngt/1/1:B/1:D 3ngt/1/1:B/1:F 3ngt/1/1:C/1:E 3ngt/1/1:D/1:F 3ngt/2/1:G/1:I 3ngt/2/1:G/1:K 3ngt/2/1:H/1:J 3ngt/2/1:K/1:I 3ngt/2/1:L/1:H 3ngt/2/1:L/1:J 3ngu/1/1:A/2:A 3ngu/1/1:A/3:A 3ngu/1/1:B/2:B 3ngu/1/1:B/3:B 3ngu/1/2:A/3:A 4kpc/1/1:A/2:A 4kpc/1/1:A/3:A 4kpc/1/1:B/2:B 4kpc/1/1:B/3:B 4kpc/1/2:A/3:A 4kpc/1/2:B/3:B 5c7p/1/1:A/2:B 5c7p/1/1:A/2:C 5c7p/1/1:C/1:B 5c7p/1/1:C/2:A 5c7p/1/2:A/1:B 5c7p/1/2:C/2:B 5cab/1/1:A/2:A 5cab/1/1:A/3:A 5cab/1/1:B/2:B 5cab/1/1:B/3:B 5cab/1/2:A/3:A 5cab/1/2:B/3:B
  • [Back to Home]