3nh2/2/1:B/1:E

Sequences

>3nh2-a2-m1-cB (length=206) [Search sequence]

GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGA
NLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSF
MMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTE
RTAVLFCEIVNRWKRLGGWPLSAAEE

>3nh2-a2-m1-cE (length=206) [Search sequence]

Structure information

PDB ID	3nh2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of RNase T in complex with a stem DNA with a 3' overhang
Assembly ID	2
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0
PubMed citation	21317904

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	E
UniProt accession	P30014	P30014
Species	562 (Escherichia coli)	562 (Escherichia coli)
Function annotation	BioLiP:3nh2B	BioLiP:3nh2E

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3nh2-a2-m1-cB_3nh2-a2-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3nh2-assembly2.cif.gz