3nja/3/3:D/1:C

Sequences

>3nja-a3-m3-cD (length=103) [Search sequence]

IGSWVLHESGRLEWSQAVHDIFGTDSATFDATEDAYFQRVHPDDRARVRRELDRHVLGDR PFDVEYRIVRPDGQVRELLERNHIQRQASGQVDHLWGTVIDTE

>3nja-a3-m1-cC (length=106) [Search sequence]

AGIGSWVLHESGRLEWSQAVHDIFGTDSATFDATEDAYFQRVHPDDRARVRRELDRHVLG DRPFDVEYRIVRPDGQVRELLERNHIQRQASGQVDHLWGTVIDTEH

Structure information

PDB ID	3nja (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of the PAS domain of a GGDEF family protein from Chromobacterium violaceum ATCC 12472.
Assembly ID	3
Resolution	2.368Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	1
Chain ID	D	C
UniProt accession	Q7NXP4	Q7NXP4
Species	243365 (Chromobacterium violaceum ATCC 12472)	243365 (Chromobacterium violaceum ATCC 12472)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3nja-a3-m3-cD_3nja-a3-m1-cC.pdb.gz

Full biological assembly Download: 3nja-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3nja/1/1:A/2:B 3nja/1/2:A/1:B 3nja/3/1:D/3:C
Other dimers with similar sequences but different poses	3nja/4/1:D/1:C 3nja/1/1:A/1:B 3nja/1/2:A/2:B 3nja/2/1:A/1:B 3nja/3/1:D/1:C 3nja/3/3:D/3:C