3njj/2/1:A/4:A

Sequences
>3njj-a2-m1-cA (length=111) [Search sequence]
GLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGF
VTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSAD
>3njj-a2-m4-cA (length=111) [Search sequence]
GLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGF
VTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSAD
Structure information
PDB ID 3njj (database links: RCSB PDB PDBe PDBj PDBsum)
Title P115A mutant of SO1698 protein, an aspartic peptidase from Shewanella oneidensis
Assembly ID 2
Resolution 1.56Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 103
Sequence identity between the two chains 1.0
PubMed citation 22493430
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID A A
UniProt accession Q8EGA7 Q8EGA7
Species 70863 (Shewanella oneidensis) 70863 (Shewanella oneidensis)
Function annotation BioLiP:3njjA BioLiP:3njjA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3njj-a2-m1-cA_3njj-a2-m4-cA.pdb.gz
Full biological assembly
Download: 3njj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3n55/1/1:A/4:A 3n55/1/2:A/6:A 3n55/1/3:A/5:A 3n55/2/1:A/4:A 3n55/5/1:A/4:A 3n55/5/2:A/6:A 3n55/5/3:A/5:A 3n55/6/1:A/4:A 3njf/1/1:A/3:C 3njf/1/1:C/2:A 3njf/1/2:C/3:A 3njf/4/1:A/3:C 3njf/4/1:C/2:A 3njf/4/2:C/3:A 3njg/1/1:A/5:A 3njg/1/2:A/4:A 3njg/1/3:A/6:A 3njg/2/1:A/5:A 3njg/5/1:A/5:A 3njg/5/2:A/4:A 3njg/5/3:A/6:A 3njh/1/1:A/1:B 3njh/2/1:C/1:D 3njh/2/2:C/2:D 3njh/2/3:C/3:D 3njh/3/1:C/1:D 3njj/1/1:A/4:A 3njj/1/2:A/6:A 3njj/1/3:A/5:A 3njk/1/1:A/4:A 3njk/1/2:A/6:A 3njk/1/3:A/5:A 3njk/2/1:A/4:A 3njl/1/1:A/4:A 3njl/1/2:A/6:A 3njl/1/3:A/5:A 3njl/2/1:A/4:A 3njm/1/1:A/6:A 3njm/1/2:A/5:A 3njm/1/3:A/4:A 3njm/2/1:A/6:A 3njn/1/1:A/1:C 3njn/1/2:A/2:C 3njn/1/3:A/3:C 3njn/2/1:A/1:C
Other dimers with similar sequences but different poses
  • 3njj/3/1:A/6:A 3n55/1/1:A/6:A 3n55/1/2:A/5:A 3n55/1/3:A/4:A 3n55/3/1:A/6:A 3n55/5/1:A/6:A 3n55/5/2:A/5:A 3n55/5/3:A/4:A 3n55/7/1:A/6:A 3njf/1/1:A/1:C 3njf/1/2:A/2:C 3njf/1/3:A/3:C 3njf/2/1:A/1:C 3njf/4/1:A/1:C 3njf/4/2:A/2:C 3njf/4/3:A/3:C 3njg/1/1:A/6:A 3njg/1/2:A/5:A 3njg/1/3:A/4:A 3njg/3/1:A/6:A 3njg/5/1:A/6:A 3njg/5/2:A/5:A 3njg/5/3:A/4:A 3njh/2/1:C/2:D 3njh/2/2:C/3:D 3njh/2/3:C/1:D 3njj/1/1:A/6:A 3njj/1/2:A/5:A 3njj/1/3:A/4:A 3njk/1/1:A/5:A 3njk/1/2:A/4:A 3njk/1/3:A/6:A 3njk/3/1:A/5:A 3njl/1/1:A/6:A 3njl/1/2:A/5:A 3njl/1/3:A/4:A 3njl/3/1:A/6:A 3njm/1/1:A/4:A 3njm/1/2:A/6:A 3njm/1/3:A/5:A 3njm/3/1:A/4:A 3njn/1/1:A/2:C 3njn/1/1:C/3:A 3njn/1/2:A/3:C 3njn/3/1:C/3:A
  • [Back to Home]