3nnq/1/2:A/2:B

Sequences

>3nnq-a1-m2-cA (length=92) [Search sequence]

HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVPDQFTFELLDFLHQLTHLSFSKKALLE RSHSPYYLNRDRTLKNITETCKACAQVNASKS

>3nnq-a1-m2-cB (length=92) [Search sequence]

HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVPDQFTFELLDFLHQLTHLSFSKKALLE RSHSPYYLNRDRTLKNITETCKACAQVNASKS

Structure information

PDB ID	3nnq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the N-terminal domain of Moloney murine leukemia virus integrase, Northeast Structural Genomics Consortium Target OR3
Assembly ID	1
Resolution	2.693Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	1.0
PubMed citation	28066922

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	P03355	P03355
Species	11801 (Moloney murine leukemia virus)	11801 (Moloney murine leukemia virus)
Function annotation	BioLiP:3nnqA	BioLiP:3nnqB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3nnq-a1-m2-cA_3nnq-a1-m2-cB.pdb.gz

Full biological assembly Download: 3nnq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3nnq/1/1:A/1:B 4nzg/1/1:A/1:B 4nzg/1/1:C/1:D
Other dimers with similar sequences but different poses	3nnq/1/1:A/2:B 3nnq/1/1:B/2:A 4nzg/1/1:A/1:D 4nzg/1/1:B/1:C 4nzg/2/1:A/1:C 4nzg/1/1:A/1:C