3no7/1/1:B/1:A

Sequences
>3no7-a1-m1-cB (length=59) [Search sequence]
KMTVTVGEERRARLRTAYTLTHLQEGHRTFSGFIAAALDAEVQRLEQRYNEGRRFENAE
>3no7-a1-m1-cA (length=60) [Search sequence]
VKMTVTVGEERRARLRTAYTLTHLQEGHRTFSGFIAAALDAEVQRLEQRYNEGRRFENAE
Structure information
PDB ID 3no7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the centromere-binding protein ParB from plasmid pCXC100
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 114
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q6EEF9 Q6EEF9
Species 31966 (Leifsonia xyli subsp. cynodontis) 31966 (Leifsonia xyli subsp. cynodontis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3no7-a1-m1-cB_3no7-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3no7-assembly1.cif.gz

[Back to Home]