3np5/1/1:C/1:D

Sequences
>3np5-a1-m1-cC (length=88) [Search sequence]
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD
VTQQAGLVKSELEAQTGLQILQTGVGQR
>3np5-a1-m1-cD (length=89) [Search sequence]
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLAD
VTQQAGLVKSELEAQTGLQILQTGVGQRE
Structure information
PDB ID 3np5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an abridged form of the mature ectodomain of the human receptor-type protein tyrosine phosphatase ICA512/IA-2 AT pH 4.5
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q16849 Q16849
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3np5D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3np5-a1-m1-cC_3np5-a1-m1-cD.pdb.gz
Full biological assembly
Download: 3np5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3n01/1/1:B/1:A 2qt7/1/1:A/1:B 2qt7/1/2:A/2:B 2qt7/2/1:A/1:B 3n4w/1/1:B/1:A 3ng8/1/1:A/1:B
  • 3n01/2/1:B/2:A 2qt7/1/1:A/2:B 3n4w/2/2:B/1:A 3ng8/2/1:B/2:A 3np5/2/1:A/2:C 3np5/3/1:B/3:D
  • 3np5/1/1:B/1:D 3np5/1/1:A/1:C
  • [Back to Home]