3npp/2/2:B/3:B

Sequences
>3npp-a2-m2-cB (length=86) [Search sequence]
GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKV
KAKGKYVETWEEVKFEDPDSVQSKLK
>3npp-a2-m3-cB (length=86) [Search sequence]
GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKV
KAKGKYVETWEEVKFEDPDSVQSKLK
Structure information
PDB ID 3npp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a Pfam DUF1093 family protein (BSU39620) from Bacillus subtilis at 2.15 A resolution
Assembly ID 2
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession P54940 P54940
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3npp-a2-m2-cB_3npp-a2-m3-cB.pdb.gz
Full biological assembly
Download: 3npp-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3npp/2/1:A/2:A 3npp/2/1:A/3:A 3npp/2/1:B/2:B 3npp/2/1:B/3:B 3npp/2/2:A/3:A
Other dimers with similar sequences but different poses
  • 3npp/2/3:A/3:B 3npp/1/1:A/1:B 3npp/2/1:A/1:B 3npp/2/2:A/2:B
  • [Back to Home]