3npp/2/3:A/3:B

Sequences

>3npp-a2-m3-cA (length=86) [Search sequence]

GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKV KAKGKYVETWEEVKFEDPDSVQSKLK

>3npp-a2-m3-cB (length=86) [Search sequence]

GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKV KAKGKYVETWEEVKFEDPDSVQSKLK

Structure information

PDB ID	3npp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a Pfam DUF1093 family protein (BSU39620) from Bacillus subtilis at 2.15 A resolution
Assembly ID	2
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	P54940	P54940
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3npp-a2-m3-cA_3npp-a2-m3-cB.pdb.gz

Full biological assembly Download: 3npp-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3npp/1/1:A/1:B 3npp/2/1:A/1:B 3npp/2/2:A/2:B
Other dimers with similar sequences but different poses	3npp/2/2:B/3:B 3npp/2/1:A/2:A 3npp/2/1:A/3:A 3npp/2/1:B/2:B 3npp/2/1:B/3:B 3npp/2/2:A/3:A