3nr6/2/2:B/4:B

Sequences
>3nr6-a2-m2-cB (length=114) [Search sequence]
TLGDQPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVGKRYRWTTDRKV
HLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL
>3nr6-a2-m4-cB (length=114) [Search sequence]
TLGDQPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVGKRYRWTTDRKV
HLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVVGPMGQPLQVL
Structure information
PDB ID 3nr6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of xenotropic murine leukemia virus-related virus (XMRV) protease
Assembly ID 2
Resolution 1.97Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID B B
UniProt accession A1Z651 A1Z651
Species 373193 (Xenotropic MuLV-related virus VP62) 373193 (Xenotropic MuLV-related virus VP62)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nr6-a2-m2-cB_3nr6-a2-m4-cB.pdb.gz
Full biological assembly
Download: 3nr6-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nr6/2/1:A/3:A 3nr6/2/1:A/4:A 3nr6/2/1:B/3:B 3nr6/2/1:B/4:B 3nr6/2/2:A/3:A 3nr6/2/2:A/4:A 3nr6/2/2:B/3:B
Other dimers with similar sequences but different poses
  • 3nr6/2/4:B/4:A 3nr6/1/1:B/1:A 3nr6/2/1:B/1:A 3nr6/2/2:B/2:A 3nr6/2/3:B/3:A 3slz/1/1:A/1:B 3sm1/1/1:B/1:A 3sm1/1/1:J/1:B 3sm1/1/1:M/1:A 3sm2/1/1:A/1:B 4exh/1/1:B/1:A 4exh/1/1:J/1:B 4exh/1/1:M/1:A 4exh/2/1:B/1:A
    		•

    [Back to Home]