3nsl/3/1:D/1:C

Sequences

>3nsl-a3-m1-cD (length=92) [Search sequence]

RPLEQAVAAIVCTFQEYAGRCGDKYKLAQAELKELLQKELATWTPTEFRECDYNKFMSVL DTNKDAEVDFVEYVRSLACLCLYCHEYFKDCP

>3nsl-a3-m1-cC (length=93) [Search sequence]

ARPLEQAVAAIVCTFQEYAGRCGDKYKLAQAELKELLQKELATWTPTEFRECDYNKFMSV LDTNKDAEVDFVEYVRSLACLCLYCHEYFKDCP

Structure information

PDB ID	3nsl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of S100A3 C30A+C68A double mutant expressed in insect cell
Assembly ID	3
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	117
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P33764	P33764
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3nsl-a3-m1-cD_3nsl-a3-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3nsl-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1kso/1/1:A/1:B 3nsi/1/1:A/1:B 3nsk/1/1:A/1:B 3nsl/1/1:B/1:A 3nsl/2/1:E/1:F 3nso/1/1:B/1:A