3nz2/2/1:H/1:L

Sequences
>3nz2-a2-m1-cH (length=179) [Search sequence]
SELEKLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQP
PFHCEFGKTIRIGDHTFINNVVLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETI
CKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKD
>3nz2-a2-m1-cL (length=179) [Search sequence]
SELEKLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQP
PFHCEFGKTIRIGDHTFINNVVLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETI
CKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKD
Structure information
PDB ID 3nz2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor
Assembly ID 2
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H L
UniProt accession Q9KLB0 Q9KLB0
Species 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)
Function annotation BioLiP:3nz2H BioLiP:3nz2L
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3nz2-a2-m1-cH_3nz2-a2-m1-cL.pdb.gz
Full biological assembly
Download: 3nz2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nz2/1/1:A/1:D 3nz2/1/1:C/1:E 3nz2/2/1:G/1:K
Other dimers with similar sequences but different poses
  • 3nz2/6/1:K/1:L 3ect/1/1:A/2:A 3ect/1/1:A/3:A 3ect/1/2:A/3:A 3nz2/1/1:A/1:B 3nz2/1/1:A/1:C 3nz2/1/1:B/1:C 3nz2/1/1:D/1:E 3nz2/1/1:D/1:F 3nz2/1/1:E/1:F 3nz2/2/1:G/1:H 3nz2/2/1:G/1:I 3nz2/2/1:H/1:I 3nz2/2/1:K/1:J 3nz2/2/1:K/1:L 3nz2/2/1:L/1:J 3nz2/3/1:A/1:B 3nz2/3/1:A/1:C 3nz2/3/1:B/1:C 3nz2/4/1:D/1:E 3nz2/4/1:D/1:F 3nz2/4/1:E/1:F 3nz2/5/1:G/1:H 3nz2/5/1:G/1:I 3nz2/5/1:H/1:I 3nz2/6/1:K/1:J 3nz2/6/1:L/1:J
  • [Back to Home]