3nzn/2/1:A/4:B

Sequences
>3nzn-a2-m1-cA (length=103) [Search sequence]
SNAVNLFGQKDRGNHVSGVDRGKVIMYGLSTCVWCKKTKKLLTDLGVDFDYVYVDRLEGK
EEEEAVEEVRRFNPSVSFPTTIINDEKAIVGFKEKEIRESLGF
>3nzn-a2-m4-cB (length=103) [Search sequence]
SNAVNLFGQKDRGNHVSGVDRGKVIMYGLSTCVWCKKTKKLLTDLGVDFDYVYVDRLEGK
EEEEAVEEVRRFNPSVSFPTTIINDEKAIVGFKEKEIRESLGF
Structure information
PDB ID 3nzn (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the Glutaredoxin from Methanosarcina mazei Go1
Assembly ID 2
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID A B
UniProt accession Q8PS17 Q8PS17
Species 2209 (Methanosarcina mazei) 2209 (Methanosarcina mazei)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3nzn-a2-m1-cA_3nzn-a2-m4-cB.pdb.gz
Full biological assembly
Download: 3nzn-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nzn/1/1:A/4:B 3nzn/1/2:A/3:B 3nzn/2/1:B/4:A
Other dimers with similar sequences but different poses
  • 3nzn/1/2:A/4:B 3nzn/1/1:A/3:B
  • 3nzn/2/4:A/4:B 3nzn/2/1:A/1:B
  • [Back to Home]