3o27/1/1:B/1:A

Sequences
>3o27-a1-m1-cB (length=57) [Search sequence]
GIRKLVVLNPRATFYLLIPKDIAEALDIKPDDTFILNMEQKDGDIVLSYKRVKELKI
>3o27-a1-m1-cA (length=60) [Search sequence]
GIRKLVVLNPRAYHTTFYLLIPKDIAEALDIKPDDTFILNMEQKDGDIVLSYKRVKELKI
Structure information
PDB ID 3o27 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of C68 from the hybrid virus-plasmid pSSVx
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 143
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q9P9J8 Q9P9J8
Species 43080 (Sulfolobus islandicus) 43080 (Sulfolobus islandicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3o27-a1-m1-cB_3o27-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3o27-assembly1.cif.gz

[Back to Home]