3o2o/6/1:F/1:G

Sequences

>3o2o-a6-m1-cF (length=85) [Search sequence]

LKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVA ETKVAMVNKYARENEHPLLCTLEKA

>3o2o-a6-m1-cG (length=85) [Search sequence]

LKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVA ETKVAMVNKYARENEHPLLCTLEKA

Structure information

PDB ID	3o2o (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of E. coli ClpS ring complex
Assembly ID	6
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	P0A8Q6	P0A8Q6
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3o2o-a6-m1-cF_3o2o-a6-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3o2o-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2wa9/7/1:N/1:G 3o2o/2/1:B/1:C 3o2o/4/1:D/1:E 3o2o/8/1:A/1:H
Other dimers with similar sequences but different poses	3o2o/7/1:G/1:H 3o2o/1/1:A/1:B 3o2o/3/1:C/1:D 3o2o/5/1:E/1:F