3o6r/1/1:A/1:B

Sequences

>3o6r-a1-m1-cA (length=256) [Search sequence]

ANTRVIELFDEFTDLIRDFIVRHEITTPEYETIMQYMISVGEAGEWPLWLDAFFETTVDS
VSYGKGNWTSSAIQGPFFKEGAPLLTGKPATLPMRADEPGDRMRFTGSVRDTSGTPITGA
VIDVWHSTNDGNYSFFSPALPDQYLLRGRVVPAEDGSIEFHSIRPVPYEIPKAGPTGQLM
NSYLGRHSWRPAHIHIRITADGYRPLITQLYFEGDPYLDSDSCSAVKSELVLPVNKIDID
GETWQLVDFNFILQHN

>3o6r-a1-m1-cB (length=256) [Search sequence]

Structure information

PDB ID	3o6r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of 4-Chlorocatechol Dioxygenase from Rhodococcus opacus 1CP in complex with pyrogallol
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	112
Sequence identity between the two chains	1.0
PubMed citation	23261399

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O67987	O67987
Species	37919 (Rhodococcus opacus)	37919 (Rhodococcus opacus)
Function annotation	BioLiP:3o6rA	BioLiP:3o6rB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3o6r-a1-m1-cA_3o6r-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3o6r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1s9a/1/1:A/1:B 3o32/1/1:B/1:A 3o5u/1/1:A/1:B 3o6j/1/1:A/1:B