3o7v/1/1:X/2:X

Sequences
>3o7v-a1-m1-cX (length=104) [Search sequence]
ETVLDFFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADG
SEVSFLEYYRKQYNQEITDLKQPLVSQPKGPALIPELCYLTGLT
>3o7v-a1-m2-cX (length=104) [Search sequence]
ETVLDFFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADG
SEVSFLEYYRKQYNQEITDLKQPLVSQPKGPALIPELCYLTGLT
Structure information
PDB ID 3o7v (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of human Hiwi1 (V361M) PAZ domain (residues 277-399) in complex with 14-mer RNA (12-bp + 2-nt overhang) containing 2'-OCH3 at its 3'-end
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 21193640
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID X X
UniProt accession Q96J94 Q96J94
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3o7vX BioLiP:3o7vX
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3o7v-a1-m1-cX_3o7v-a1-m2-cX.pdb.gz
Full biological assembly
Download: 3o7v-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3o3i/1/1:X/2:X 3o6e/1/1:X/2:X

[Back to Home]