3oa0/1/1:D/1:C

Sequences

>3oa0-a1-m1-cD (length=307) [Search sequence]

MTRFALTGLAGYIAPRHLKAIKEVGGVLVASLDPATNVGLVDSFFPEAEFFTEPEAFEAY
LEDLRDRGEGVDYLSIASPNHLHYPQIRMALRLGANALSEKPLVLWPEEIARLKELEART
GRRVYTVLQLRVHPSLLALKERLGQEKGAKDVVLTYVTGRGKWYGKSWKVDEAKSGGLAT
NIGIHFFDLLAWLFGRALHVEVHARTPTVNAGYLELEGARVRWFLSIDPSFVPEPLRRQG
KRTYRSIAVDGEEVEFSEGDLHTEVYRKTLAGEGFGLDEAAEAIRVAALLRTLPLSQPSP
ENRHPFL

>3oa0-a1-m1-cC (length=310) [Search sequence]

Structure information

PDB ID	3oa0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the WlbA (WbpB) Dehydrogenase from Thermus thermophilus in complex with NAD and UDP-GlcNAcA
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0
PubMed citation	20690587

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q72KX8	Q72KX8
Species	262724 (Thermus thermophilus HB27)	262724 (Thermus thermophilus HB27)
Function annotation	BioLiP:3oa0D	BioLiP:3oa0C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3oa0-a1-m1-cD_3oa0-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3oa0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3o9z/1/1:A/1:B 3o9z/1/1:D/1:C 3oa0/1/1:A/1:B
Other dimers with similar sequences but different poses	3o9z/1/1:D/1:A 3o9z/1/1:B/1:C 3oa0/1/1:B/1:C 3oa0/1/1:D/1:A