3oa6/1/1:A/1:B

Sequences
>3oa6-a1-m1-cA (length=84) [Search sequence]
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAA
EDHVLRDTDENRRLQRKLARKAVA
>3oa6-a1-m1-cB (length=84) [Search sequence]
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAA
EDHVLRDTDENRRLQRKLARKAVA
Structure information
PDB ID 3oa6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human MSL3 Chromodomain bound to DNA and H4K20me1 peptide
Assembly ID 1
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 20657587
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q8N5Y2 Q8N5Y2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3oa6A BioLiP:3oa6B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3oa6-a1-m1-cA_3oa6-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3oa6-assembly1.cif.gz

[Back to Home]