3obh/1/1:A/1:B

Sequences
>3obh-a1-m1-cA (length=64) [Search sequence]
FTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKGKGITLSNEEFQTV
DAFK
>3obh-a1-m1-cB (length=65) [Search sequence]
AEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKGKGITLSNEEFQ
TVDAF
Structure information
PDB ID 3obh (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of protein SP_0782 (7-79) from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR104
Assembly ID 1
Resolution 1.891Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 0.984
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession A0A0H2UPA7 A0A0H2UPA7
Species 1313 (Streptococcus pneumoniae) 1313 (Streptococcus pneumoniae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3obh-a1-m1-cA_3obh-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3obh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2l3a/1/1:A/1:B 4g06/1/1:A/1:B

[Back to Home]