3obh/1/1:A/1:B

Sequences

>3obh-a1-m1-cA (length=64) [Search sequence]

FTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKGKGITLSNEEFQTV DAFK

>3obh-a1-m1-cB (length=65) [Search sequence]

AEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKGKGITLSNEEFQ TVDAF

Structure information

PDB ID	3obh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray crystal structure of protein SP_0782 (7-79) from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR104
Assembly ID	1
Resolution	1.891Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	0.984

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A0A0H2UPA7	A0A0H2UPA7
Species	1313 (Streptococcus pneumoniae)	1313 (Streptococcus pneumoniae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3obh-a1-m1-cA_3obh-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3obh-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2l3a/1/1:A/1:B 4g06/1/1:A/1:B