3ocm/3/1:B/1:A

Sequences
>3ocm-a3-m1-cB (length=143) [Search sequence]
FGVEERNVSGVLTLAERSIRSITPRTDVSWVNIDDDAATIRQQLTAAPHSFFPVCRGSLD
EVVGIGRAKDLVADLITEGRVRRNRLRDPIIVHESIGILRLDTLKRSRGQLVLVADEFGA
IEGLVTPIDVFEAIAGEFPDEDE
>3ocm-a3-m1-cA (length=146) [Search sequence]
AFGVEERNVSGVLTLAERSIRSITPRTDVSWVNIDDDAATIRQQLTAAPHSFFPVCRGSL
DEVVGIGRAKDLVADLITEGRVRRNRLRDPIIVHESIGILRLDTLKRSRGQLVLVADEFG
AIEGLVTPIDVFEAIAGEFPDEDELP
Structure information
PDB ID 3ocm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a domain from a possible membrane protein of Bordetella parapertussis
Assembly ID 3
Resolution 1.801Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 97
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q7W867 Q7W867
Species 519 (Bordetella parapertussis) 519 (Bordetella parapertussis)
Function annotation BioLiP:3ocmB BioLiP:3ocmA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ocm-a3-m1-cB_3ocm-a3-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ocm-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ocm/1/1:B/1:A 3ocm/1/2:B/2:A 3ocm/1/3:B/3:A 3ocm/1/4:B/4:A 3ocm/2/1:B/1:A 3ocm/2/5:B/5:A
Other dimers with similar sequences but different poses
  • 3ocm/1/2:A/4:A 3ocm/1/1:A/3:A 3ocm/1/1:A/4:A 3ocm/1/2:A/3:A
  • 3ocm/1/4:B/1:A 3ocm/1/1:B/3:A 3ocm/1/2:B/4:A 3ocm/1/3:B/2:A
  • 3ocm/2/1:B/5:B 3ocm/2/1:A/5:A
  • [Back to Home]