3ol0/1/1:B/1:C

Sequences
>3ol0-a1-m1-cB (length=41) [Search sequence]
HPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG
>3ol0-a1-m1-cC (length=41) [Search sequence]
HPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG
Structure information
PDB ID 3ol0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Monofoil-4P homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
Assembly ID 1
Resolution 1.483Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ol0-a1-m1-cB_3ol0-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3ol0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ogf/1/1:C/1:B 3ol0/1/1:B/1:A 3ol0/1/1:C/1:A

[Back to Home]