3onr/1/1:B/1:C

Sequences
>3onr-a1-m1-cB (length=70) [Search sequence]
SVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLEV
SFKMRPSQPL
>3onr-a1-m1-cC (length=70) [Search sequence]
SVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLEV
SFKMRPSQPL
Structure information
PDB ID 3onr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the calcium chelating immunodominant antigen, calcium dodecin (Rv0379),from Mycobacterium tuberculosis with a novel calcium-binding site
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q6MX43 Q6MX43
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3onr-a1-m1-cB_3onr-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3onr-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3onr/1/1:B/1:A 3onr/1/1:C/1:A 3onr/1/1:D/1:E 3onr/1/1:D/1:F 3onr/1/1:E/1:F 3onr/1/1:G/1:H 3onr/1/1:G/1:I 3onr/1/1:H/1:I 3onr/1/1:J/1:L 3onr/1/1:K/1:J 3onr/1/1:K/1:L
Other dimers with similar sequences but different poses
  • 3onr/1/1:D/1:K 3onr/1/1:A/1:G 3onr/1/1:A/1:L 3onr/1/1:C/1:F 3onr/1/1:C/1:H 3onr/1/1:D/1:B 3onr/1/1:E/1:I 3onr/1/1:F/1:H 3onr/1/1:G/1:L 3onr/1/1:J/1:E 3onr/1/1:J/1:I 3onr/1/1:K/1:B
  • [Back to Home]