3oow/1/1:C/1:H

Sequences
>3oow-a1-m1-cC (length=155) [Search sequence]
SVQVGVIGSKSDWSTKECCDILDNLGIGYECEVVSAHRTPDKFDYAETAKERGLKVIIAG
AGGAAHLPGVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQPAGIPVATFAIGAGAKNAALF
AASILQHTDINIAKALAEFRAEQTRFVLENPDPRE
>3oow-a1-m1-cH (length=155) [Search sequence]
SVQVGVIGSKSDWSTKECCDILDNLGIGYECEVVSAHRTPDKFDYAETAKERGLKVIIAG
AGGAAHLPGVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQPAGIPVATFAIGAGAKNAALF
AASILQHTDINIAKALAEFRAEQTRFVLENPDPRE
Structure information
PDB ID 3oow (database links: RCSB PDB PDBe PDBj PDBsum)
Title Octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from Francisella tularensis subsp. tularensis SCHU S4.
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C H
UniProt accession Q5NGE9 Q5NGE9
Species 119856 (Francisella tularensis subsp. tularensis) 119856 (Francisella tularensis subsp. tularensis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3oow-a1-m1-cC_3oow-a1-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3oow-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3oow/1/1:B/1:D 3oow/1/1:E/1:F 3oow/1/1:G/1:A 3opq/1/1:B/1:D 3opq/1/1:C/1:H 3opq/1/1:E/1:F 3opq/1/1:G/1:A
Other dimers with similar sequences but different poses
  • 3opq/1/1:F/1:A 3oow/1/1:A/1:C 3oow/1/1:A/1:F 3oow/1/1:B/1:C 3oow/1/1:B/1:F 3oow/1/1:E/1:D 3oow/1/1:G/1:E 3oow/1/1:G/1:H 3oow/1/1:H/1:D 3opq/1/1:A/1:C 3opq/1/1:C/1:B 3opq/1/1:E/1:D 3opq/1/1:E/1:G 3opq/1/1:F/1:B 3opq/1/1:G/1:H 3opq/1/1:H/1:D
  • 3opq/1/1:F/1:G 3oow/1/1:A/1:H 3oow/1/1:C/1:D 3oow/1/1:E/1:B 3oow/1/1:G/1:F 3opq/1/1:A/1:H 3opq/1/1:C/1:D 3opq/1/1:E/1:B
    		•

    [Back to Home]