3op9/1/2:A/4:A

Sequences
>3op9-a1-m2-cA (length=106) [Search sequence]
IQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYSGETKPDIEKLIRLATYFHLSID
ELVGYVQEVWNDLSLKQWLLSLNLRSEEEIAKIKILVDTVETLYPN
>3op9-a1-m4-cA (length=106) [Search sequence]
IQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYSGETKPDIEKLIRLATYFHLSID
ELVGYVQEVWNDLSLKQWLLSLNLRSEEEIAKIKILVDTVETLYPN
Structure information
PDB ID 3op9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of transcriptional regulator from Listeria innocua
Assembly ID 1
Resolution 1.898Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession Q926P6 Q926P6
Species 1642 (Listeria innocua) 1642 (Listeria innocua)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3op9-a1-m2-cA_3op9-a1-m4-cA.pdb.gz
Full biological assembly
Download: 3op9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3op9/1/3:A/4:A 3op9/1/1:A/2:A
  • 3op9/1/1:A/4:A 3op9/1/2:A/3:A
  • [Back to Home]