3oq2/2/2:A/2:B

Sequences
>3oq2-a2-m2-cA (length=99) [Search sequence]
NDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHRLLS
EMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL
>3oq2-a2-m2-cB (length=102) [Search sequence]
MYGNDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHR
LLSEMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL
Structure information
PDB ID 3oq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a CRISPR associated protein Cas2 from Desulfovibrio vulgaris
Assembly ID 2
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 101
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q72WF4 Q72WF4
Species 882 (Desulfovibrio vulgaris str. Hildenborough) 882 (Desulfovibrio vulgaris str. Hildenborough)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3oq2-a2-m2-cA_3oq2-a2-m2-cB.pdb.gz
Full biological assembly
Download: 3oq2-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3oq2/1/1:A/1:B 3oq2/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 3oq2/3/3:A/4:B 3oq2/2/1:A/2:B 3oq2/2/2:A/1:B 3oq2/3/1:A/2:B
  • 3oq2/3/1:A/4:B 3oq2/3/3:A/2:B
  • [Back to Home]