3oq2/3/3:A/4:B

Sequences

>3oq2-a3-m3-cA (length=99) [Search sequence]

NDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHRLLS EMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL

>3oq2-a3-m4-cB (length=102) [Search sequence]

MYGNDAMLVLISYDVSFEDPGGQRRLRRIAKACQDYGQRVQYSVFECVVDPAQWAKLKHR LLSEMDKEKDCLRFYYLGANWRNKVEHVGAKPAYDPEGPLIL

Structure information

PDB ID	3oq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a CRISPR associated protein Cas2 from Desulfovibrio vulgaris
Assembly ID	3
Resolution	1.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	4
Chain ID	A	B
UniProt accession	Q72WF4	Q72WF4
Species	882 (Desulfovibrio vulgaris str. Hildenborough)	882 (Desulfovibrio vulgaris str. Hildenborough)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3oq2-a3-m3-cA_3oq2-a3-m4-cB.pdb.gz

Full biological assembly Download: 3oq2-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3oq2/2/1:A/2:B 3oq2/2/2:A/1:B 3oq2/3/1:A/2:B
Other dimers with similar sequences but different poses	3oq2/2/2:A/2:B 3oq2/1/1:A/1:B 3oq2/2/1:A/1:B 3oq2/3/1:A/4:B 3oq2/3/3:A/2:B