3otw/1/1:C/1:F

Sequences
>3otw-a1-m1-cC (length=156) [Search sequence]
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMIQLATK
SFKNVECVAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMP
TLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISK
>3otw-a1-m1-cF (length=156) [Search sequence]
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMIQLATK
SFKNVECVAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMP
TLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISK
Structure information
PDB ID 3otw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural and Functional Studies of Helicobacter pylori Wild-Type and Mutated Proteins Phosphopantetheine adenylyltransferase
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession O26010 O26010
Species 85962 (Helicobacter pylori 26695) 85962 (Helicobacter pylori 26695)
Function annotation BioLiP:3otwC BioLiP:3otwF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3otw-a1-m1-cC_3otw-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3otw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3otw/1/1:B/1:A 3otw/1/1:D/1:E
Other dimers with similar sequences but different poses
  • 3nv7/1/3:A/4:A 3nv7/1/1:A/2:A
  • 3nv7/1/2:A/4:A 3nv7/1/1:A/3:A
  • 3nv7/1/1:A/4:A 3nv7/1/2:A/3:A
  • 3otw/1/1:D/1:F 3otw/1/1:B/1:C 3otw/1/1:B/1:E 3otw/1/1:C/1:E 3otw/1/1:D/1:A 3otw/1/1:F/1:A
  • 3otw/1/1:B/1:D 3otw/1/1:C/1:A
    		•

    [Back to Home]