3oud/1/1:A/1:B

Sequences
>3oud-a1-m1-cA (length=99) [Search sequence]
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF
>3oud-a1-m1-cB (length=99) [Search sequence]
PQITLWQRPIVTIKIGGQLKEALLNTGADDTTLEEVNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF
Structure information
PDB ID 3oud (database links: RCSB PDB PDBe PDBj PDBsum)
Title MDR769 HIV-1 protease complexed with CA/p2 hepta-peptide
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 0.99
PubMed citation 21394574
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P35963 P35963
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
Function annotation BioLiP:3oudA BioLiP:3oudB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3oud-a1-m1-cA_3oud-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3oud-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1rpi/1/1:A/1:B 1rq9/1/1:A/1:B 1rv7/1/1:A/1:B 1sgu/1/1:A/1:B 1sh9/1/1:A/1:B 1tw7/1/1:A/1:B 2fdd/1/1:A/1:B 3oq7/1/1:A/2:A 3oqa/1/1:A/2:A 3oqd/1/1:A/2:A 3ots/1/1:A/1:B 3oty/1/1:A/1:B 3ou1/1/1:A/1:B 3ou3/1/1:A/1:B 3ou4/1/1:A/1:B 3oua/1/1:A/1:B 3oub/1/1:A/1:B 3ouc/1/1:A/1:B 3pj6/1/1:A/2:A 3r0w/1/1:A/1:B 3r0y/1/1:A/1:B 3so9/1/1:A/1:B 3spk/1/1:A/1:B 4eyr/1/1:A/1:B 4fae/1/1:A/1:B 4faf/1/1:A/1:B 4gye/1/1:A/1:B 4gzf/1/1:A/1:B 4l1a/1/1:A/1:B 4nkk/1/1:A/2:A 4yoa/1/1:A/2:A 4yob/1/1:A/2:A

[Back to Home]