3p0e/1/1:A/1:B

Sequences

>3p0e-a1-m1-cA (length=285) [Search sequence]

FVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELG
FIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSG
GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTL
VGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGL
KAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLG

>3p0e-a1-m1-cB (length=285) [Search sequence]

Structure information

PDB ID	3p0e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of hUPP2 in an active conformation with bound 5-benzylacyclouridine
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	196
Sequence identity between the two chains	1.0
PubMed citation	21855639

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O95045	O95045
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3p0eA	BioLiP:3p0eB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3p0e-a1-m1-cA_3p0e-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3p0e-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xrf/1/1:A/2:A 2xrf/2/1:C/1:B 3p0e/2/1:D/1:C 3p0e/3/1:F/1:E 3p0f/1/1:A/2:A