3p19/3/1:C/1:D

Sequences

>3p19-a3-m1-cC (length=218) [Search sequence]

KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFD
TAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKA
RNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTE
LLSGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQ

>3p19-a3-m1-cD (length=238) [Search sequence]

Structure information

PDB ID	3p19 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Improved NADPH-dependent Blue Fluorescent Protein
Assembly ID	3
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	127
Sequence identity between the two chains	1.0
PubMed citation	21397029

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q9F172	Q9F172
Species	672 (Vibrio vulnificus)	672 (Vibrio vulnificus)
Function annotation	BioLiP:3p19C	BioLiP:3p19D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3p19-a3-m1-cC_3p19-a3-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3p19-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3p19/1/1:B/1:A 3p19/1/1:C/1:D 3p19/2/1:B/1:A
Other dimers with similar sequences but different poses	3p19/1/1:B/1:D 3p19/1/1:C/1:A