3p1x/3/1:B/1:A

Sequences
>3p1x-a3-m1-cB (length=64) [Search sequence]
GKNPVELNEKRRGLKYELISETGGSHDKRFVEVEVDGQKFQGAGSNKKVAKAYAALAALE
KLFP
>3p1x-a3-m1-cA (length=68) [Search sequence]
GKNPVELNEKRRGLKYELISETGGSHDKRFVEVEVDGQKFQGAGSNKKVAKAYAALAALE
KLFPDTPL
Structure information
PDB ID 3p1x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
Assembly ID 3
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q12906 Q12906
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3p1x-a3-m1-cB_3p1x-a3-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3p1x-assembly3.cif.gz

[Back to Home]