3p8d/1/1:A/1:B

Sequences
>3p8d-a1-m1-cA (length=53) [Search sequence]
SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
>3p8d-a1-m1-cB (length=53) [Search sequence]
SEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Structure information
PDB ID 3p8d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the second Tudor domain of human PHF20 (homodimer form)
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9BVI0 Q9BVI0
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3p8d-a1-m1-cA_3p8d-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3p8d-assembly1.cif.gz
Similar dimers

[Back to Home]