3p8m/1/1:C/1:D

Sequences
>3p8m-a1-m1-cC (length=42) [Search sequence]
SVSRGTQTEGGSGMKQLEDKVEELLSKNYHLENEVARLKKLV
>3p8m-a1-m1-cD (length=43) [Search sequence]
GSVSRGTQTEGGSGMKQLEDKVEELLSKNYHLENEVARLKKLV
Structure information
PDB ID 3p8m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper
Assembly ID 1
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P03069 P03069
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3p8m-a1-m1-cC_3p8m-a1-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3p8m-assembly1.cif.gz

[Back to Home]