3pf6/2/1:C/1:B

Sequences
>3pf6-a2-m1-cC (length=53) [Search sequence]
SQFQEVRPVAQALYPTHPSTKDALEEARLLFPGGTHHDFRALGYHNTLVKVEE
>3pf6-a2-m1-cB (length=55) [Search sequence]
GSQFQEVRPVAQALYPTHPSTKDALEEARLLFPGGTHHDFRALGYHNTLVKVEEQ
Structure information
PDB ID 3pf6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of uncharacterized protein PP-LUZ7_gp033 from Pseudomonas phage LUZ7.
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 148
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession C8ZKC7 C8ZKC7
Species 655097 (Pseudomonas phage LUZ7) 655097 (Pseudomonas phage LUZ7)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3pf6-a2-m1-cC_3pf6-a2-m1-cB.pdb.gz
Full biological assembly
Download: 3pf6-assembly2.cif.gz
Similar dimers

[Back to Home]