3pg9/2/1:D/1:E

Sequences

>3pg9-a2-m1-cD (length=338) [Search sequence]

MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVE
SVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSVEGREMLMETAHFLSEL
GVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPKVAEYADI
IQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIR
TFEKATRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGAHGIIVEVH
PEPEKALSDGKQSLDFELFKELVQEMKKLADALGVKVN

>3pg9-a2-m1-cE (length=338) [Search sequence]

Structure information

PDB ID	3pg9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Thermotoga maritima DAH7P synthase in complex with inhibitor
Assembly ID	2
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	102
Sequence identity between the two chains	1.0
PubMed citation	21282100

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	E
UniProt accession	Q9WYH8	Q9WYH8
Species	2336 (Thermotoga maritima)	2336 (Thermotoga maritima)
Function annotation	BioLiP:3pg9D	BioLiP:3pg9E

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3pg9-a2-m1-cD_3pg9-a2-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3pg9-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1rzm/1/1:A/1:B 1rzm/1/2:A/2:B 1vr6/1/1:B/1:D 1vr6/1/1:C/1:A 3pg9/1/1:A/1:G 3pg9/1/1:B/1:F 3pg9/2/1:C/1:H
Other dimers with similar sequences but different poses	3pg9/1/1:A/1:B 1rzm/1/1:A/2:A 1rzm/1/1:B/2:B 1vr6/1/1:B/1:A 1vr6/1/1:C/1:D 3pg8/1/1:B/1:A 3pg9/1/1:F/1:G 3pg9/2/1:C/1:D 3pg9/2/1:E/1:H 3pg9/1/1:B/1:G 1vr6/1/1:B/1:C 1vr6/1/1:D/1:A 3pg9/1/1:A/1:F 3pg9/2/1:C/1:E 3pg9/2/1:D/1:H