3pgg/1/3:A/3:B

Sequences

>3pgg-a1-m3-cA (length=78) [Search sequence]

NIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADKRVMVNR LETILLSGNNVAMLVPGG

>3pgg-a1-m3-cB (length=80) [Search sequence]

GGNIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKAKRVMVN RLETILLSGNNVAMLVPGGD

Structure information

PDB ID	3pgg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of cryptosporidium parvum u6 snrna-associated sm-like protein lsm5
Assembly ID	1
Resolution	2.14Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	0.987

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	A	B
UniProt accession	Q5CXX3	Q5CXX3
Species	5807 (Cryptosporidium parvum)	5807 (Cryptosporidium parvum)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3pgg-a1-m3-cA_3pgg-a1-m3-cB.pdb.gz

Full biological assembly Download: 3pgg-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3pgg/1/1:A/1:B 3pgg/1/1:A/3:B 3pgg/1/2:A/1:B 3pgg/1/2:A/2:B 3pgg/1/3:A/2:B