3phd/1/1:D/1:A

Sequences

>3phd-a1-m1-cD (length=84) [Search sequence]

WCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHP LVLSYIDLSAWCYYCQAYVHHQAL

>3phd-a1-m1-cA (length=102) [Search sequence]

PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNS GHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGED

Structure information

PDB ID	3phd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human HDAC6 in complex with ubiquitin
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0
PubMed citation	22069321

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q9UBN7	Q9UBN7
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3phdD	BioLiP:3phdA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3phd-a1-m1-cD_3phd-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3phd-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3phd/1/1:D/1:B 3phd/1/1:C/1:A