3phd/1/1:D/1:B

Sequences
>3phd-a1-m1-cD (length=84) [Search sequence]
WCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHP
LVLSYIDLSAWCYYCQAYVHHQAL
>3phd-a1-m1-cB (length=100) [Search sequence]
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNS
GHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Structure information
PDB ID 3phd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human HDAC6 in complex with ubiquitin
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
PubMed citation 22069321
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession Q9UBN7 Q9UBN7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3phdD BioLiP:3phdB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3phd-a1-m1-cD_3phd-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3phd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3phd/1/1:D/1:A 3phd/1/1:C/1:B
  • [Back to Home]